PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v3948170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 337aa    MW: 38010 Da    PI: 9.1282
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v3948170.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.61e-5261381128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+ +yL+kkv++ +l++ ++i+evdiyk++Pw+Lp k+  +ekewyfFs+rd+ky++g r+nra++sgyWkatg+dk++++
  Lj1g3v3948170.1   6 LPPGFRFHPTDEELILHYLRKKVASIPLPV-SIIAEVDIYKLDPWELPGKALFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVA 98 
                      79****************************.89***************8777899*************************************** PP

              NAM  95 k......kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +       +  +g+kk Lvfykg+ pkg+kt+W+mheyrl
  Lj1g3v3948170.1  99 SlpgggrAQDSIGVKKALVFYKGKPPKGVKTNWIMHEYRL 138
                      99998766667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-653165IPR003441NAC domain
PROSITE profilePS5100561.8716165IPR003441NAC domain
PfamPF023657.4E-287138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MAESNLPPGF RFHPTDEELI LHYLRKKVAS IPLPVSIIAE VDIYKLDPWE LPGKALFGEK  60
EWYFFSPRDR KYPNGARPNR AAASGYWKAT GTDKTIVASL PGGGRAQDSI GVKKALVFYK  120
GKPPKGVKTN WIMHEYRLVD HNKPIKLKDT SMRLDDWVLC RIYKKSKCAL SPTEAGTGVG  180
EVDQAEEQLL NDTVFPNTLI SQKSVSFSNL LDAMDYSMLS SFLSENHYNQ TGTGSSAGFN  240
NLDQQSSTIN TTNGYMFQMK NTQLNHSASN TENTRPKREL SNIDEETVYP SKKYLNSSCN  300
FTNINAQLEK NPQWNHLMKQ SLLNQQLLLG PHLHFQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-74116912169NO APICAL MERISTEM PROTEIN
1ut4_B9e-74116912169NO APICAL MERISTEM PROTEIN
1ut7_A9e-74116912169NO APICAL MERISTEM PROTEIN
1ut7_B9e-74116912169NO APICAL MERISTEM PROTEIN
3swm_A1e-73116915172NAC domain-containing protein 19
3swm_B1e-73116915172NAC domain-containing protein 19
3swm_C1e-73116915172NAC domain-containing protein 19
3swm_D1e-73116915172NAC domain-containing protein 19
3swp_A1e-73116915172NAC domain-containing protein 19
3swp_B1e-73116915172NAC domain-containing protein 19
3swp_C1e-73116915172NAC domain-containing protein 19
3swp_D1e-73116915172NAC domain-containing protein 19
4dul_A9e-74116912169NAC domain-containing protein 19
4dul_B9e-74116912169NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.159380.0cell culture| floral bud
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0065510.0AP006551.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT35D17, TM0104, complete sequence.
GenBankAP0065520.0AP006552.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT28G12, TM0107, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236142.10.0transcriptional factor NAC11
SwissprotA2YMR04e-87NAC10_ORYSI; NAC transcription factor ONAC010
TrEMBLB9U5I10.0B9U5I1_SOYBN; Transcriptional factor NAC11
TrEMBLA0A0B2PKC60.0A0A0B2PKC6_GLYSO; NAC domain-containing protein 29
STRINGGLYMA16G04740.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66212750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.11e-106NAC domain containing protein 47